RAD51AP1 anticorps (Middle Region)

N° du produit ABIN633433

Cet anticorps Lapin Polyclonal détecte spécifiquement RAD51AP1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour RAD51AP1 anticorps (Middle Region) (ABIN633433)

Antigène: RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD51AP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAD51AP1 anticorps

Épitope: Middle Region

Specificité: RAD51 AP1 antibody was raised against the middle region of RAD51 P1

Purification: Affinity purified

Immunogène: RAD51 AP1 antibody was raised using the middle region of RAD51 P1 corresponding to a region with amino acids EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD51AP1 Blocking Peptide, (ABIN937694), is also available for use as a blocking control in assays to test for specificity of this RAD51AP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Concentration: Lot specific

Buffer: Supplied as cell culture supernatant.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD51AP1

Antigène: RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))

Autre désignation: RAD51AP1

Sujet: RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA.

Poids moléculaire: 37 kDa (MW of target protein)